FTHL17 Rabbit Polyclonal Antibody

CAT#: TA339588

Rabbit Polyclonal Anti-FTHL17 Antibody

Product Images

WB Suggested Anti-FTHL17 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FTHL17 antibody: synthetic peptide directed towards the N terminal of human FTHL17. Synthetic peptide located within the following region: MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: ferritin heavy chain like 17
• Database Link:
  NP_114100
  Entrez Gene 53940 Human
  UniProt ID Q9BXU8
• Background: This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.
• Synonyms: CT38
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane