Antibodies

Jump to Filters
View as table Download
Dysadherin (FXYD5) (Center) Rabbit Polyclonal Antibody
AP51745PU-N

USD 450.00

2 Weeks

Dysadherin (FXYD5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of Human Dysadherin / FXYD5
Dysadherin (FXYD5) Goat Polyclonal Antibody
TA302772

USD 375.00

5 Days

Goat Polyclonal Antibody against FXYD5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GKCRQLSRLCRNHCR, from the C Terminus of the protein sequence according to NP_054883.1; NP_659003.1.
Dysadherin (FXYD5) Rabbit Polyclonal Antibody
TA331461

USD 310.00

5 Days

Rabbit polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the N terminal of human FXYD5. Synthetic peptide located within the following region: LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
Dysadherin (FXYD5) Rabbit Polyclonal Antibody
TA338570

USD 375.00

5 Days

Rabbit Polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG
Dysadherin (FXYD5) Rabbit Polyclonal Antibody
TA338571

USD 310.00

5 Days

Rabbit Polyclonal Anti-FXYD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD5 antibody: synthetic peptide directed towards the middle region of human FXYD5. Synthetic peptide located within the following region: DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST