Germany
Japan
United Kingdom
China
GABPB2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GABPB2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GABPB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC29891 antibody: synthetic peptide directed towards the C terminal of human MGC29891. Synthetic peptide located within the following region: EEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQLQEANRRAQEYRHQL |
Gabpb2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Gabpb2 |
GABPB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GABPB2 |
GABPB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 239-448 of human GABPB2 (NP_653219.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GABPB2