GABPB2 Rabbit Polyclonal Antibody

CAT#: TA339795

Rabbit Polyclonal Anti-GABPB2 Antibody

Product Images

WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC29891 antibody: synthetic peptide directed towards the C terminal of human MGC29891. Synthetic peptide located within the following region: EEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQLQEANRRAQEYRHQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: GA binding protein transcription factor beta subunit 2
• Database Link:
  NP_653219
  Entrez Gene 126626 Human
  UniProt ID Q8TAK5
• Background: MGC29891 (GABPB2) contains 5 ANK repeats. It may function as transcription factor capable of interacting with purine rich repeats (GA repeats).
• Synonyms: GABPB-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 83%; Yeast: 82%

Reference Data

• Protein Families: Transcription Factors