Rabbit Polyclonal Anti-GALNT13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13. Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI |
Rabbit Polyclonal Anti-Galnt13 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Galnt13 antibody is: synthetic peptide directed towards the C-terminal region of Rat Galnt13. Synthetic peptide located within the following region: EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP |
Germany
Japan
United Kingdom
China