Rabbit Polyclonal Anti-GBX1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GBX-1 antibody: synthetic peptide directed towards the middle region of human GBX-1. Synthetic peptide located within the following region: AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP |
GBX1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide between 117-147 amino acids from the Central region of human GBX1 |
Rabbit Polyclonal Anti-Gbx1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gbx1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RGARRGPGSAMQRAAGGGAPGGSGGSSGGPGAAFSIDSLIGPPPPRSGHL |
Germany
Japan
United Kingdom
China