GBX1 Rabbit Polyclonal Antibody

CAT#: TA339216

Rabbit Polyclonal Anti-GBX1

Product Images

WB Suggested Anti-GBX1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GBX-1 antibody: synthetic peptide directed towards the middle region of human GBX-1. Synthetic peptide located within the following region: AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: gastrulation brain homeobox 1
• Database Link:
  NP_001092304
  Entrez Gene 2636 Human
  UniProt ID Q14549
• Background: GBX1 contains 1 homeobox DNA-binding domain. The exact functions of GBX1 remain unknown.
• Synonyms: Huh-17
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%