Rabbit Polyclonal Anti-GH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC |
GH2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 18-45 amino acids from the N-terminal region of human Growth hormone 2 |
Rabbit polyclonal anti-GH (Growth Hormone) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human growth hormone |
Rabbit Polyclonal anti-GH2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG |
Germany
Japan
United Kingdom
China
