GH2 Rabbit Polyclonal Antibody

CAT#: TA329466

Rabbit Polyclonal anti-GH2 antibody

Product Images

WB Suggested Anti-GH2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: PANC1 cell lysateGH2 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: growth hormone 2
• Database Link:
  NP_072050
  Entrez Gene 2689 Human
  UniProt ID P01242
• Background: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
• Synonyms: GH-V; GHL; GHV; hGH-V
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction