Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE |
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR |
Rabbit Polyclonal Anti-GHRHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV |
Rabbit Polyclonal Anti-GHRHR Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GHRHR antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Panda, Dog (94%); Zebu, Bovine (89%); Rabbit, Pig (83%). |
Rabbit Polyclonal Anti-GHRHR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Elephant (94%); Panda, Bat, Horse, Pig (88%); Marmoset, Zebu, Bovine, Dog (81%). |
Rabbit Polyclonal Anti-GHRHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Zebu, Rabbit, Pig (94%); Panda, Bovine, Dog, Horse (88%). |
GHRHR rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GHRHR |
GHRHR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GHRHR