Antibodies

View as table Download

Rabbit Polyclonal Anti-PTPN5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PTPN5 antibody was raised against an 18 amino acid peptide near the amino terminus of human PTPN5.

Rabbit Polyclonal anti-GLIS2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE

Rabbit Polyclonal anti-GLIS2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF

GLIS2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 172-202 amino acids from the Central region of Human GLIS2.