Rabbit Polyclonal Anti-PTPN5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PTPN5 antibody was raised against an 18 amino acid peptide near the amino terminus of human PTPN5. |
Rabbit Polyclonal Anti-PTPN5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PTPN5 antibody was raised against an 18 amino acid peptide near the amino terminus of human PTPN5. |
Rabbit Polyclonal anti-GLIS2 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE |
Rabbit Polyclonal anti-GLIS2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLIS2 antibody: synthetic peptide directed towards the N terminal of human GLIS2. Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF |
GLIS2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 172-202 amino acids from the Central region of Human GLIS2. |