Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Glutaredoxin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 40-100). [Swiss-Prot# P35754] |
Rabbit Polyclonal Anti-GLRX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLRX antibody: synthetic peptide directed towards the N terminal of human GLRX. Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV |
Rabbit Polyclonal Anti-GLRX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLRX |
Glrx1 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
GLRX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GLRX |
Active filters
Target Symbol
- GLRX