Glutaredoxin 1 (GLRX) Rabbit Polyclonal Antibody

CAT#: TA335035

Rabbit Polyclonal Anti-GLRX Antibody

Product Images

WB Suggested Anti-GLRX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLRX antibody: synthetic peptide directed towards the N terminal of human GLRX. Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: glutaredoxin
• Database Link:
  NP_002055
  Entrez Gene 2745 Human
  UniProt ID P35754
• Background: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.
• Synonyms: GRX; GRX1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Sheep: 93%; Zebrafish: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome