Antibodies

Jump to Filters
View as table Download
TXNL2 (GLRX3) Rabbit Polyclonal Antibody
TA344258

USD 475.00

5 Days

Rabbit Polyclonal Anti-GLRX3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLRX3 antibody: synthetic peptide directed towards the N terminal of human GLRX3. Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
TXNL2 (GLRX3) (N-term) Rabbit Polyclonal Antibody
AP54426PU-N

USD 450.00

2 Weeks

TXNL2 (GLRX3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 88-118 amino acids from the N-terminal region of human TXNL2
TXNL2 (GLRX3) Mouse Monoclonal Antibody [Clone ID: OTI2B10]
CF811056

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GLRX3 mouse monoclonal antibody,clone OTI2B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TXNL2 (GLRX3) Mouse Monoclonal Antibody [Clone ID: OTI2F2]
CF811095

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLRX3 mouse monoclonal antibody,clone OTI2F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TXNL2 (GLRX3) Mouse Monoclonal Antibody [Clone ID: OTI4C8]
CF811096

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLRX3 mouse monoclonal antibody,clone OTI4C8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TXNL2 (GLRX3) Rabbit Polyclonal Antibody
TA376608

USD 220.00

3 Weeks

GLRX3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human GLRX3 (NP_001186797.1).
Modifications Unmodified