TXNL2 (GLRX3) Rabbit Polyclonal Antibody

CAT#: TA344258

Rabbit Polyclonal Anti-GLRX3 Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human glutaredoxin 3 (GLRX3)
    • 20 ug

USD 823.00


Transient overexpression lysate of glutaredoxin 3 (GLRX3)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "GLRX3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GLRX3 antibody: synthetic peptide directed towards the N terminal of human GLRX3. Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name glutaredoxin 3
Background GLRX3 may play a role in regulating the function of the thioredoxin system.
Synonyms GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Mouse: 85%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.