TXNL2 (GLRX3) Rabbit Polyclonal Antibody

CAT#: TA344258

Rabbit Polyclonal Anti-GLRX3 Antibody - N-terminal region

Product Images

WB Suggested Anti-GLRX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysateGLRX3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GLRX3 antibody: synthetic peptide directed towards the N terminal of human GLRX3. Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: glutaredoxin 3
• Database Link:
  NP_006532
  Entrez Gene 10539 Human
  UniProt ID O76003
• Background: GLRX3 may play a role in regulating the function of the thioredoxin system.
• Synonyms: GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome