Antibodies

View as table Download

Rabbit Polyclonal Anti-GMPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA

GMP Synthase (GMPS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GMPS

GMP Synthase (GMPS) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human GMPS

GMPS Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 394-693 of human GMPS (NP_003866.1).
Modifications Unmodified