Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GNLY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG |
GNLY mouse monoclonal antibody, clone B-L38, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
GNLY mouse monoclonal antibody, clone B-R32, Azide Free
| Reactivities | Human |
GNLY mouse monoclonal antibody, clone B-L38, Azide Free
| Reactivities | Human |
GNLY mouse monoclonal antibody, clone B-L38, Purified
| Applications | FC |
| Reactivities | Human |
GNLY (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human GNLY |
Active filters
Target Symbol
- GNLY