Antibodies

Jump to Filters
View as table Download
GNRH2 (Center) Rabbit Polyclonal Antibody
AP51886PU-N

USD 450.00

2 Weeks

GNRH2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 32~62 amino acids from the Central region of human GNRH2 / Progonadoliberin-2
GNRH2 Rabbit Polyclonal Antibody
TA357265

USD 360.00

5 Days

GNRH2 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
GNRH2 Rabbit Polyclonal Antibody
TA360785

USD 360.00

5 Days

GNRH2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GNRH2
GNRH2 Rabbit Polyclonal Antibody
TA376669

USD 220.00

3 Weeks

GNRH2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human GNRH2 (NP_001492.1).
Modifications Unmodified