GNRH2 Rabbit Polyclonal Antibody

CAT#: TA357265

GNRH2 Antibody

Product Images

Rabbit Anti-GNRH2 antibody Catalog Number: ARP55770 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
• Specificity: Expected reactivity: Human
  Homology: Human: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 13 kDa
• Gene Name: gonadotropin releasing hormone 2
• Database Link:
  NP_001492
  Entrez Gene 2797 Human
  UniProt ID O43555
• Background: The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.
• Synonyms: GnRH-II; LH-RHII; OTTHUMP00000030076; OTTHUMP00000030077

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway