Rabbit Polyclonal Anti-GOLGA7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOLGA7 antibody: synthetic peptide directed towards the middle region of human GOLGA7. Synthetic peptide located within the following region: ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL |
Rabbit Polyclonal Anti-GOLGA7 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOLGA7 antibody: synthetic peptide directed towards the N terminal of human GOLGA7. Synthetic peptide located within the following region: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL |
GOLGA7 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GOLGA7 |
GOLGA7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human GOLGA7 (NP_001167595.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
