GOLGA7 Rabbit Polyclonal Antibody

CAT#: TA345065

Rabbit Polyclonal Anti-GOLGA7 Antibody - N-terminal region

Product Images

WB Suggested Anti-GOLGA7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GOLGA7 antibody: synthetic peptide directed towards the N terminal of human GOLGA7. Synthetic peptide located within the following region: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: golgin A7
• Database Link:
  NP_057183
  Entrez Gene 51125 Human
  UniProt ID Q7Z5G4
• Background: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
• Synonyms: GCP16; GOLGA3AP1; GOLGA7A; HSPC041
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 79%