GOLGA7 (NM_016099) Human Recombinant Protein

CAT#: TP312483

Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1

Product Images

Coomassie blue staining of purified GOLGA7 protein (Cat# TP312483). The protein was produced from HEK293T cells transfected with GOLGA7 cDNA clone (Cat# RC212483) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212483 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL
  ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057183
• Locus ID: 51125
• UniProt ID: Q7Z5G4
• Cytogenetics: 8p11.21
• Refseq Size: 1919
• Refseq ORF: 411
• Synonyms: GCP16; GOLGA3AP1; GOLGA7A; HSPC041
• Summary: May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.[UniProtKB/Swiss-Prot Function]