GOLGA7 (NM_001002296) Human Mass Spec Standard

CAT#: PH304399

GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296)

Product Images

Coomassie blue staining of purified GOLGA7 protein (Cat# TP304399). The protein was produced from HEK293T cells transfected with GOLGA7 cDNA clone (Cat# RC204399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204399
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204399 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL
  ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001002296
• RefSeq Size: 2042
• RefSeq ORF: 411
• Synonyms: GCP16; GOLGA3AP1; GOLGA7A; HSPC041
• Locus ID: 51125
• UniProt ID: Q7Z5G4
• Cytogenetics: 8p11.21