GOLGA7 (NM_001002296) Human Recombinant Protein
CAT#: TP304399
Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204399 protein sequence
Red=Cloning site Green=Tags(s) MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002296 |
Locus ID | 51125 |
UniProt ID | Q7Z5G4 |
Cytogenetics | 8p11.21 |
Refseq Size | 2042 |
Refseq ORF | 411 |
Synonyms | GCP16; GOLGA3AP1; GOLGA7A; HSPC041 |
Summary | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414189 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424147 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432569 | GOLGA7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414189 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 1 |
USD 325.00 |
|
LY424147 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 2 |
USD 325.00 |
|
LY432569 | Transient overexpression lysate of golgin A7 (GOLGA7), transcript variant 3 |
USD 325.00 |
|
PH304399 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_001002296) |
USD 2,055.00 |
|
PH312483 | GOLGA7 MS Standard C13 and N15-labeled recombinant protein (NP_057183) |
USD 2,055.00 |
|
TP312483 | Recombinant protein of human golgi autoantigen, golgin subfamily a, 7 (GOLGA7), transcript variant 1 |
USD 823.00 |
|
TP329569 | Purified recombinant protein of Homo sapiens golgin A7 (GOLGA7), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review