Rabbit Polyclonal Anti-GORASP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GORASP1 antibody: synthetic peptide directed towards the N terminal of human GORASP1. Synthetic peptide located within the following region: PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV |
Rabbit Polyclonal Anti-GORASP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GORASP1 antibody: synthetic peptide directed towards the N terminal of human GORASP1. Synthetic peptide located within the following region: MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNK |
GRASP65 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 221-440 of human GRASP65 (NP_114105.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
