Antibodies

Jump to Filters
View as table Download
Glypican 6 (GPC6) Rabbit Polyclonal Antibody
TA349331

USD 380.00

In Stock

Rabbit Polyclonal Anti-GPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GPC6
Glypican 6 (GPC6) (C-term) Rabbit Polyclonal Antibody
AP51904PU-N

USD 450.00

2 Weeks

Glypican 6 (GPC6) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 496-528 amino acids from the C-terminal region of human GPC6
Glypican 6 (GPC6) Rabbit Polyclonal Antibody
TA338144

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPC6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC6 antibody is: synthetic peptide directed towards the N-terminal region of Human GPC6. Synthetic peptide located within the following region: AYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFEN
Glypican 6 (GPC6) Rabbit Polyclonal Antibody
TA351222

USD 345.00

2 Weeks

Rabbit Polyclonal Anti-GPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC6
GPC6 Rabbit Polyclonal Antibody
TA367067

USD 380.00

4 Weeks

GPC6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC6
Glypican 6 (GPC6) Rabbit Polyclonal Antibody
TA376702

USD 220.00

3 Weeks

GPC6 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-530 of human GPC6 (NP_005699.1).
Modifications Unmodified