Glypican 6 (GPC6) Rabbit Polyclonal Antibody

CAT#: TA338144

Rabbit Polyclonal Anti-GPC6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GPC6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GPC6 antibody is: synthetic peptide directed towards the N-terminal region of Human GPC6. Synthetic peptide located within the following region: AYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFEN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name glypican 6
Background The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases.
Synonyms OMIMD1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 90%; Guinea pig: 90%; Horse: 82%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.