Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR108 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR108 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR108. Synthetic peptide located within the following region: KPKSTPAVIQGPSGKDKDLVLGLSHLNNSYNFSFHVVIGSQAEEGQYSLN |
Rabbit Polyclonal Anti-GPR108 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR108 antibody was raised against synthetic 18 amino acid peptide from 1st cytoplasmic domain of human GPR108. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey, Rat, Hamster, Dog, Horse (94%); Mouse, Panda, Bovine, Pig (89%). |
Rabbit Polyclonal Anti-GPR108 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR108 antibody was raised against synthetic 18 amino acid peptide from 1st cytoplasmic domain of human GPR108. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Marmoset, Pig (94%); Mouse, Rat, Bovine, Horse (89%); Panda (83%). |
GPR108 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-260 of human GPR108 (NP_001073921.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPR108