GPR108 Rabbit Polyclonal Antibody

CAT#: TA334118

Rabbit Polyclonal Anti-GPR108 Antibody

Product Images

Host: Rabbit; Target Name: GPR108; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPR108 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR108. Synthetic peptide located within the following region: KPKSTPAVIQGPSGKDKDLVLGLSHLNNSYNFSFHVVIGSQAEEGQYSLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: G protein-coupled receptor 108
• Database Link:
  NP_001073921
  Entrez Gene 56927 Human
  UniProt ID Q9NPR9
• Background: The function of this protein remains unknown.
• Synonyms: LUSTR2
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane