Antibodies

Jump to Filters
View as table Download
GPR84 Rabbit Polyclonal Antibody
TA316854

USD 425.00

In Stock

GPR84 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Horse
Conjugation Unconjugated
Immunogen GPR84 antibody was raised against synthetic 19 amino acid peptide from 2nd extracellular domain of human GPR84. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Horse (100%); Gibbon (95%); Elephant, Bovine, Rabbit (89%); Mouse, Dog (84%).
GPR84 Rabbit Polyclonal Antibody
TA338025

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPR84 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR84 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR84. Synthetic peptide located within the following region: ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS