Rabbit Polyclonal Anti-GPSM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human GPSM1. Synthetic peptide located within the following region: DSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSS |
GPSM1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GPSM1 |
GPSM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 158-457 of human GPSM1 (NP_056412.5). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
