GPSM1 Rabbit Polyclonal Antibody

CAT#: TA338298

Rabbit Polyclonal Anti-GPSM1 Antibody

Product Images

WB Suggested Anti-GPSM1 Antibody; Titration: 1.0 ug/ml; Positive Control: NCI-H226 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human GPSM1. Synthetic peptide located within the following region: DSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: G-protein signaling modulator 1
• Database Link:
  NP_001139110
  Entrez Gene 26086 Human
  UniProt ID Q86YR5
• Background: G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal activity of G-protein signaling systems. The protein contains seven tetratricopeptide repeats in its N-terminal half and four G-protein regulatory (GPR) motifs in its C-terminal half. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: AGS3
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Dog: 79%