Rabbit Polyclonal Anti-GRIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GRIP2. Synthetic peptide located within the following region: IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR |
Rabbit Polyclonal Anti-Grip2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Grip2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Grip2. Synthetic peptide located within the following region: GLTISGGTDKDGKPRVSNLRPGGLAARSDLLNVGDYIRSVNGIHLTRLRH |
Germany
Japan
United Kingdom
China
