GRIP2 Rabbit Polyclonal Antibody

CAT#: TA338324

Rabbit Polyclonal Anti-GRIP2 Antibody

Product Images

WB Suggested Anti-GRIP2 Antibody; Titration: 1.0 ug/ml; Positive Control: COLO205 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRIP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GRIP2. Synthetic peptide located within the following region: IRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: glutamate receptor interacting protein 2
• Database Link:
  NP_001073892
  Entrez Gene 80852 Human
  UniProt ID Q9C0E4
• Background: GRIP2 may play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.
• Synonyms: glutamate receptor interacting protein 2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome