Rabbit Polyclonal Anti-GRPEL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRPEL1 antibody: synthetic peptide directed towards the N terminal of human GRPEL1. Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD |
Carrier-free (BSA/glycerol-free) GRPEL1 mouse monoclonal antibody,clone OTI6G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GRPEL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-217 of human GRPEL1 (NP_079472.1). |
| Modifications | Unmodified |
GRPEL1 mouse monoclonal antibody,clone OTI6G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRPEL1 mouse monoclonal antibody,clone OTI6G6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GRPEL1 mouse monoclonal antibody,clone OTI6G6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GRPEL1 mouse monoclonal antibody,clone OTI6G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China