Germany
Japan
United Kingdom
China
Rabbit anti-GTF2F2 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GTF2F2 |
Antibodies
View as table Download
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the C terminal of human GTF2F2. Synthetic peptide located within the following region: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD |
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ |
Rabbit Polyclonal anti-GTF2F2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ |
Active filters
Target Symbol
- GTF2F2