Germany
Japan
United Kingdom
China
TFIIF (GTF2F2) Rabbit Polyclonal Antibody
Product Images
Other products for "GTF2F2"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human, Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 28 kDa |
| Gene Name | general transcription factor IIF subunit 2 |
| Database Link | |
| Background | GTranscription Factor Antibodies2F2 is required for both basal and HIV-1 Tat-activated transcription. GTranscription Factor Antibodies2F2 synergizes with HIV-1 Tat and the cellular co-activator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter. |
| Synonyms | BTF4; RAP30; TF2F2; TFIIF |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77% |
| Reference Data | |
| Protein Families | Transcription Factors |
| Protein Pathways | Basal transcription factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.