Rabbit Polyclonal Anti-Gtpbp4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Gtpbp4 antibody is: synthetic peptide directed towards the C-terminal region of Rat Gtpbp4. Synthetic peptide located within the following region: CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK |
Rabbit Polyclonal Anti-GTPBP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP4 antibody: synthetic peptide directed towards the C terminal of human GTPBP4. Synthetic peptide located within the following region: MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR |
GTPBP4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 385-634 of human GTPBP4 (NP_036473.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China