Gtpbp4 Rabbit Polyclonal Antibody

CAT#: TA334449

Rabbit Polyclonal Anti-Gtpbp4 Antibody

Product Images

WB Suggested Anti-Gtpbp4 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gtpbp4 antibody is: synthetic peptide directed towards the C-terminal region of Rat Gtpbp4. Synthetic peptide located within the following region: CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: GTP binding protein 4
• Database Link:
  NP_446141
  Entrez Gene 114300 Rat
• Background: Gtpbp4 may be involved in GTP-mediated signaling associated with cell proliferation and renal function.
• Synonyms: CRFG; FLJ10686; FLJ10690; FLJ39774; NGB; NOG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 79%