Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Galnt3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Galnt3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE |
GALNT3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GALNT3 |
GALNT3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GALNT3 |
GALNT3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GALNT3 (NP_004473.2). |
| Modifications | Unmodified |
GALNT3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human GALNT3 (NP_004473.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GALNT3