Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti Alarin (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Pro-Ala-His-Arg-Ser-Ser-Thr-Phe-Pro-Lys-Trp- Val-Thr-Lys-Thr-Glu-Arg-Gly-Arg-Gln-Pro-Leu-Arg-Ser-OH coupled to a carrier protein. |
Rabbit polyclonal anti Galanin-Like Peptide (GALP) (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Met-Ala-Pro-Pro-Ser-Val-Pro-Leu-Val-Leu-Leu-Leu- Val-Leu-Leu-Leu-Ser-Leu-Ala-Glu-Pro-Ala-Ser-Ala-Ser-Ala-his-Arg-Gly- Arg-Gly-Gly-Trp-Trn-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu- His-Leu-pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu- Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro- Pro-Gln-Pro-Ser-Lys-Arg-Asn-Val-Met-Glu-Thr-Phe-Ala-Lys- Pro-Glu-Ile- Gly-Asp-Leu-Gly-Met-Leu-Ser-Met-Lys-Ile-Pro-Lys-Glu-Glu-Asp-Val-Ile- Lys-Ser-OH coupled to carrier protein. |
GALP Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP |
GALP Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMET |
GALP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GALP |
Active filters
Target Symbol
- GALP