GALP Rabbit Polyclonal Antibody

CAT#: TA358382

GALP Antibody

Product Images

Rabbit Anti-GALP antibody Catalog Number: ARP63211 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMET
• Specificity: Expected reactivity: Human, Pig
  Homology: Human: 100%; Pig: 93%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 13 kDa
• Gene Name: galanin like peptide
• Database Link:
  NP_001139018
  Entrez Gene 85569 Human
  UniProt ID Q9UBC7
• Background: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors.
• Synonyms: alarin

Reference Data

• Protein Families: Secreted Protein