Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GAS8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAS8 antibody: synthetic peptide directed towards the middle region of human GAS8. Synthetic peptide located within the following region: RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK |
Rabbit Polyclonal Anti-GAS8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAS8 antibody: synthetic peptide directed towards the N terminal of human GAS8. Synthetic peptide located within the following region: VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM |
Carrier-free (BSA/glycerol-free) GAS8 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GAS8 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAS8 |
GAS8 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GAS8 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GAS8 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GAS8 mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GAS8