Rabbit Polyclonal Anti-GATAD2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATAD2B antibody: synthetic peptide directed towards the N terminal of human GATAD2B. Synthetic peptide located within the following region: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLK |
Rabbit Polyclonal Anti-GATAD2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GATAD2B Antibody: synthetic peptide directed towards the N terminal of human GATAD2B. Synthetic peptide located within the following region: HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR |
Rabbit Polyclonal Anti-GATAD2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GATAD2B Antibody: synthetic peptide directed towards the N terminal of human GATAD2B. Synthetic peptide located within the following region: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLK |
Gatad2b Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
GATAD2B Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GATAD2B (NP_065750.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China