p66 beta (GATAD2B) Rabbit Polyclonal Antibody

CAT#: TA331822

Rabbit Polyclonal Anti-GATAD2B Antibody

Product Images

WB Suggested Anti-GATAD2B Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GATAD2B Antibody: synthetic peptide directed towards the N terminal of human GATAD2B. Synthetic peptide located within the following region: HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: GATA zinc finger domain containing 2B
• Database Link:
  NP_065750
  Entrez Gene 57459 Human
  UniProt ID Q8WXI9
• Background: GATAD2B contains 1GATA-type zinc finger. GATAD2B was identified as potent transcriptional repressors interacting with MBD2 and MBD3. GATAD2B, one of the Mi-2/NuRD complex subunits, mediate MBD2 and histone interaction
• Synonyms: MRD18; P66beta; p68
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transcription Factors