Antibodies

Jump to Filters
View as table Download
GTP cyclohydrolase 1 (GCH1) Goat Polyclonal Antibody
TA305613

USD 375.00

2 Weeks

Goat Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKVHIGYLPNKQ, from the internal region of the protein sequence according to NP_000152.1 ; NP_001019195.1 ; NP_001019241.1 ; NP_001019242.1 .
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA321072

USD 345.00

In Stock

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342673

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342674

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA323417

USD 345.00

4 Weeks

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA376517

USD 220.00

3 Weeks

GCH1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human GCH1 (NP_000152.1).
Modifications Unmodified