Antibodies

Jump to Filters
View as table Download
MIR16 (GDE1) Rabbit Polyclonal Antibody
TA342023

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN