MIR16 (GDE1) Rabbit Polyclonal Antibody

CAT#: TA342023

Rabbit Polyclonal Anti-GDE1 Antibody

Product Images

WB Suggested Anti-GDE1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: glycerophosphodiester phosphodiesterase 1
• Database Link:
  NP_057725
  Entrez Gene 51573 Human
  UniProt ID Q9NZC3
• Background: Has glycerophosphoinositol phosphodiesterase activity. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.
• Synonyms: 363E6.2; MIR16
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycerophospholipid metabolism