Rabbit Polyclonal Anti-GEMIN7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GEMIN7 antibody is: synthetic peptide directed towards the N-terminal region of Human GEMIN7. Synthetic peptide located within the following region: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQES |
GEMIN7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GEMIN7 |
GEMIN7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human GEMIN7 (NP_078983.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
