Rabbit polyclonal anti-GHITM antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GHITM. |
Rabbit polyclonal anti-GHITM antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GHITM. |
Goat Anti-MICS1 / GHITM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PSREYATKTRIGIR, from the internal region of the protein sequence according to NP_055209.2. |
Rabbit Polyclonal Anti-Ghitm Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ghitm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI |
Rabbit Polyclonal Anti-GHITM Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GHITM |
GHITM rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GHITM |