Antibodies

View as table Download

Rabbit polyclonal anti-GHITM antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GHITM.

Goat Anti-MICS1 / GHITM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PSREYATKTRIGIR, from the internal region of the protein sequence according to NP_055209.2.

Rabbit Polyclonal Anti-Ghitm Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ghitm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI

Rabbit Polyclonal Anti-GHITM Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GHITM

GHITM rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GHITM